PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_012630-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 287aa    MW: 32820 Da    PI: 4.4318
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_012630-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.72.2e-1992145356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k+++++ eq++ Le+ Fe ++++  e++ +LAk+lgL+ rqV +WFqNrRa++k
  AHYPO_012630-RA  92 KKRRLSVEQVQFLEKSFEVENKLEPERKIQLAKELGLQPRQVAIWFQNRRARWK 145
                      56689************************************************9 PP

2HD-ZIP_I/II116.81.2e-3791173183
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLeke 83 
                      ekkrrls eqv++LE+sFe e+kLeperK +la+eLglqprqva+WFqnrRAR+ktkqlEkd++ L+++  +  +e++++++e
  AHYPO_012630-RA  91 EKKRRLSVEQVQFLEKSFEVENKLEPERKIQLAKELGLQPRQVAIWFQNRRARWKTKQLEKDFDILQSKPSNTYTETKTVQEE 173
                      69*******************************************************************99999999988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.41E-2080149IPR009057Homeodomain-like
PROSITE profilePS5007117.62187147IPR001356Homeobox domain
SMARTSM003899.1E-2090151IPR001356Homeobox domain
PfamPF000461.3E-1692145IPR001356Homeobox domain
CDDcd000869.75E-1992148No hitNo description
Gene3DG3DSA:1.10.10.601.0E-1994154IPR009057Homeodomain-like
PRINTSPR000316.0E-6118127IPR000047Helix-turn-helix motif
PROSITE patternPS000270122145IPR017970Homeobox, conserved site
PRINTSPR000316.0E-6127143IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MEKVEVMAGR VFNGSSSNVG TSLLFNQSLP RSSNSSEPFF LSGSSSFLGS SSMMSFEDVC  60
RGKRTERPFF CTYDQEDIGD EDFDDYFHQP EKKRRLSVEQ VQFLEKSFEV ENKLEPERKI  120
QLAKELGLQP RQVAIWFQNR RARWKTKQLE KDFDILQSKP SNTYTETKTV QEEPIIESAS  180
ESEDHQISLF NYKQEDLSSA KSDVIDSDSP HYVDATHHSA FLDPTDSSYA FEADHSDISQ  240
DDEDYLSKSL LPSSHFDPPA NSCTYGLSGE DHASLYWPYW DINLKM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139147RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678585.11e-133PREDICTED: homeobox-leucine zipper protein HAT5-like
TrEMBLA0A0K9R4D11e-137A0A0K9R4D1_SPIOL; Uncharacterized protein
STRINGVIT_17s0000g05630.t011e-100(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-35homeobox 1